DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and MYD88

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001166038.2 Gene:MYD88 / 4615 HGNCID:7562 Length:304 Species:Homo sapiens


Alignment Length:332 Identity:83/332 - (25%)
Similarity:144/332 - (43%) Gaps:57/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GSGSGTGTGLGHFNETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISELAKQKGFVD-- 128
            |.|:|:...:...:..||:||.:..|.:||..||.:..:.:      ||   :.||::..|..  
Human     5 GPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAA------DW---TALAEEMDFEYLE 60

  Fly   129 ----ENANNPMDLVLISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQRFIMKQEQR 189
                |...:|...:|.:|..|  ..|.||.|...|..:.|.||..::..::.:|.|::|:||:|.
Human    61 IRQLETQADPTGRLLDAWQGR--PGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQE 123

  Fly   190 ------QTALVEACPPPPSDCFETNNNYSSSNNITVGQSVQILSDEDQRCVQMGQPLPRYNACVL 248
                  |.|.|::..|..::.                ..:..|.|      .:|....|::|.:.
Human   124 EAEKPLQVAAVDSSVPRTAEL----------------AGITTLDD------PLGHMPERFDAFIC 166

  Fly   249 YAEADIDHATEIMNNLESERYNLRLFLRHRDMLMG-----VPFEHVQLSHFMATR----CNHLIV 304
            |..:||....|::..||...|.|:|.:..||:|.|     :..|.::..  :|.|    |..::|
Human   167 YCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKR--LARRPRGGCRRMVV 229

  Fly   305 VLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILYKT-DMHIPQTLGIYTHIKYAGDSKLFNFW 368
            |:::::|:|.|..:...|...:....|.:::|||.||. ....|..|...|...|........||
Human   230 VVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFW 294

  Fly   369 DKLARSL 375
            .:||::|
Human   295 TRLAKAL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326 23/87 (26%)
TIR_2 242..375 CDD:304906 39/142 (27%)
MYD88NP_001166038.2 Death_MyD88 29..106 CDD:260026 23/87 (26%)
TIR 160..304 CDD:214587 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159628
Domainoid 1 1.000 50 1.000 Domainoid score I11744
eggNOG 1 0.900 - - E1_28PXY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380911at33208
OrthoFinder 1 1.000 - - FOG0006849
OrthoInspector 1 1.000 - - oto91631
orthoMCL 1 0.900 - - OOG6_108536
Panther 1 1.100 - - LDO PTHR15079
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5112
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.