DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and tlr4bb

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_997978.2 Gene:tlr4bb / 403132 ZFINID:ZDB-GENE-040219-9 Length:819 Species:Danio rerio


Alignment Length:409 Identity:88/409 - (21%)
Similarity:157/409 - (38%) Gaps:119/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DVSYRRYRTAGMVVAE----GVMDSGSGSGTGTGLGHF--NETPLSAL-----GIE-------TR 91
            |:||.|.....:...:    .|:.....|.:|..|.:|  |.|.|..|     |||       |.
Zfish   449 DISYTRVHFNTLTFQDLHNLTVLKMAGNSFSGDKLSYFLQNLTSLEVLDISQCGIEKVSMRSFTG 513

  Fly    92 TQLSR--MLNRKKVLRSEEGYQRDWRGISELAKQKGFVDENA--NNPMDLVLISWSQRSPQTAKV 152
            ||..|  .|:|.|::..:...|.:...::.:     ::|:|:  ..|:|::     |:.|..   
Zfish   514 TQKLRHLYLSRNKLMVLDFLTQPELTHLTSV-----YIDKNSITTIPLDVL-----QKLPMN--- 565

  Fly   153 GHLEHFLGIIDRWDVCDDIQENLAKDTQRFIMKQEQRQTALVE----ACPPPPSDCFETNNNYSS 213
                     :..:|:..:..:.....|. ||:...|:|..|.:    .|     ..|..|.::.:
Zfish   566 ---------LSEFDLSSNSIDCSCSQTD-FILWIIQKQNILKQLENIRC-----KTFSANTDFKA 615

  Fly   214 ----------SNNITVGQSV---------QILSDEDQRCVQM-----------GQPLPRYNACVL 248
                      ...:|:..||         .||..:....||.           ||....|:|.|:
Zfish   616 IDFDIDYCVHKKRLTIVLSVICVTFVVVLAILLYKFWFYVQYCFILFSGYRSPGQQECSYDAFVI 680

  Fly   249 YAEADIDHA---TEIMNNLESERYNLRLFLRHRDMLMGVPF-EHVQLSHFMATRCNHLIVVLTEE 309
            :  :..|.|   .|:|.|||:....::|.|..||...|... .::.....|.:|  .:|||:::.
Zfish   681 F--SSYDEAWVMNELMENLENGVPPIQLCLHMRDFQAGKSIASNIIDEGIMGSR--KIIVVVSQH 741

  Fly   310 FLRS---------PENTYLVNFTQKIQI-------ENHTRKIIPILYKTDMHIPQTLGIYTHIKY 358
            |:.|         .::.:|:.....|.|       |..|:|:.. |:|   |:.:.    |::|:
Zfish   742 FIDSSWCRFEFELAQSRFLMERNANIIIIILEDVAERKTKKVFG-LHK---HLKKN----TYLKW 798

  Fly   359 AGDSKLFN--FWDKLARSL 375
            :.| .|.|  ||.:|.:::
Zfish   799 SRD-PLSNMRFWIRLRKAI 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326 15/85 (18%)
TIR_2 242..375 CDD:304906 39/154 (25%)
tlr4bbNP_997978.2 leucine-rich repeat 56..77 CDD:275380
LRR_8 77..133 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
leucine-rich repeat 126..148 CDD:275380
leucine-rich repeat 149..173 CDD:275380
leucine-rich repeat 174..200 CDD:275380
leucine-rich repeat 201..222 CDD:275380
LRR_RI <325..531 CDD:238064 23/81 (28%)
leucine-rich repeat 326..369 CDD:275380
leucine-rich repeat 370..395 CDD:275380
LRR_8 394..455 CDD:290566 3/5 (60%)
leucine-rich repeat 396..419 CDD:275380
leucine-rich repeat 420..444 CDD:275380
LRR_8 443..527 CDD:290566 22/77 (29%)
leucine-rich repeat 445..467 CDD:275380 4/17 (24%)
leucine-rich repeat 468..492 CDD:275380 6/23 (26%)
LRR_8 491..576 CDD:290566 21/106 (20%)
leucine-rich repeat 493..516 CDD:275380 7/22 (32%)
leucine-rich repeat 517..540 CDD:275380 5/22 (23%)
leucine-rich repeat 541..565 CDD:275380 6/33 (18%)
TIR 675..816 CDD:214587 39/153 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.