DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and tlr2

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_005170910.1 Gene:tlr2 / 403125 ZFINID:ZDB-GENE-040219-6 Length:818 Species:Danio rerio


Alignment Length:153 Identity:36/153 - (23%)
Similarity:68/153 - (44%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RYNACVLYAEADIDHATEIM-NNLESERYNLRLFLRHRDM-----LMGVPFEHVQLSHFMATRCN 300
            ||:|.|.|::.|.:...||: ..||..:.:..|.|..||.     ::....:.::.|:       
Zfish   671 RYDAFVSYSQHDAEWVEEILVAELEDTQPSFSLCLHKRDFRPGRWIVDNIIDSIEKSY------- 728

  Fly   301 HLIVVLTEEFLRSPENTYLVNFTQ-KIQIENHTRKII----PILYKTDMHIP-------QTLGIY 353
            ..:.||:|.|:.|....|.::|:. :|..|::...::    ||..:|   ||       :.:...
Zfish   729 RTLFVLSEHFVSSEWCRYELDFSHFRIMDEHNDSAVLVLLEPIKKET---IPKRFCKLRKIMNSR 790

  Fly   354 THIKYAGD-SKLFNFWDKLARSL 375
            |::::..| .|...||..|..:|
Zfish   791 TYLEWPEDEDKRDEFWSNLRAAL 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 35/151 (23%)
tlr2XP_005170910.1 leucine-rich repeat 85..105 CDD:275378
leucine-rich repeat 106..129 CDD:275378
LRR_8 108..163 CDD:290566
leucine-rich repeat 130..153 CDD:275378
leucine-rich repeat 154..178 CDD:275378
leucine-rich repeat 179..192 CDD:275378
LRR_RI <390..501 CDD:238064
leucine-rich repeat 390..418 CDD:275380
LRR_8 418..478 CDD:290566
leucine-rich repeat 419..444 CDD:275380
leucine-rich repeat 445..467 CDD:275380
leucine-rich repeat 468..488 CDD:275380
leucine-rich repeat 489..508 CDD:275380
leucine-rich repeat 509..530 CDD:275380
leucine-rich repeat 531..554 CDD:275380
TIR 671..814 CDD:214587 36/153 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.