DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and Il18rap

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_017452283.1 Gene:Il18rap / 373540 RGDID:727867 Length:627 Species:Rattus norvegicus


Alignment Length:263 Identity:54/263 - (20%)
Similarity:100/263 - (38%) Gaps:80/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NYSSSNNI---TVGQSVQILS-DEDQRC-------------VQMGQ--PLP--------RYNACV 247
            :|:.|:|:   ||...||:.: |||...             |::|:  .||        ||:..|
  Rat   221 DYTQSDNVSSWTVRAVVQVRTIDEDTNVKPDILDPVTDTLDVELGKAFTLPCRVQFGFQRYSKPV 285

  Fly   248 L--YA-----EADIDHATE--IMNNLESERYNLRLFLR---HRDMLMGVPFEHVQLSHFMATRCN 300
            :  |.     |.:|....|  |.:.|::|.....:|||   .||                     
  Rat   286 IKWYVKESTQEWEISEFVEKRIQSTLKNEVIEHTVFLREVTQRD--------------------- 329

  Fly   301 HLIVVLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILY----KTDMHIPQTLG---IYTH-IK 357
                 |:.:|:...:|: :.|.|:.|::..  ::.:..||    .|.|.:...:.   :|.| |:
  Rat   330 -----LSRKFVCFAQNS-IGNTTRTIRLRK--KEGVVFLYILLGMTVMLVGVLVAAALLYWHWIE 386

  Fly   358 YAGDSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKDVTDMPNY 422
            .....:.|...|:..|...:.|||..|:    ...||..|:...::...:.:.:..:.:.:...|
  Rat   387 VVLLCRTFKNKDETLRDKKEFDAFVSYA----NWSSPETEATGSLSEEHLALNLFPEVLENTYGY 447

  Fly   423 NSC 425
            :.|
  Rat   448 SLC 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 31/152 (20%)
Il18rapXP_017452283.1 Ig_6 101..154 CDD:408247
Ig 263..353 CDD:416386 24/116 (21%)
Ig strand B 266..275 CDD:409353 2/8 (25%)
Ig strand C 284..289 CDD:409353 1/4 (25%)
Ig strand D 297..308 CDD:409353 2/10 (20%)
Ig strand E 314..322 CDD:409353 1/7 (14%)
Ig strand F 333..339 CDD:409353 1/5 (20%)
Ig strand G 343..349 CDD:409353 2/5 (40%)
TIR 410..558 CDD:396246 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.