DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and Sigirr

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_006536238.2 Gene:Sigirr / 24058 MGIID:1344402 Length:414 Species:Mus musculus


Alignment Length:189 Identity:48/189 - (25%)
Similarity:79/189 - (41%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YNACVLYAEADIDH--ATEIMNNLESERYNLRLFLRHRDML-MGVPFEHVQLSHFMATRCNHLIV 304
            |:|.|.|::...|.  ...|:......|...:|||..||:| ...|...:.::   .:||..|||
Mouse   169 YDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLEDRDLLPRAEPSADLLVN---LSRCRRLIV 230

  Fly   305 VLTEEFLRSP--ENTYLVNFTQKIQIENHTRKIIPILYKTDMHIP-----QTLGIYTHI------ 356
            ||::.||..|  ..::.....:.:::   ||:.|.|.::.....|     :.|..:.|:      
Mouse   231 VLSDAFLSRPWCSQSFREGLCRLLEL---TRRPIFITFEGQRREPIHPALRLLRQHRHLVTLVLW 292

  Fly   357 KYAGDSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKD 415
            |....:...:||.:|..:|          .|:||. .|||..      |..|:| :|||
Mouse   293 KPGSVTPSSDFWKELQLAL----------PRKVQY-RPVEGD------PQTRLQ-DDKD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 35/147 (24%)
SigirrXP_006536238.2 Ig_3 14..106 CDD:372822
TIR 169..331 CDD:366714 45/185 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.