DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and Myd88

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_034981.1 Gene:Myd88 / 17874 MGIID:108005 Length:296 Species:Mus musculus


Alignment Length:324 Identity:86/324 - (26%)
Similarity:142/324 - (43%) Gaps:53/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GSGSGTGTGLGHFN-ETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISELAKQKGFVD- 128
            ||||     |..|. ..||.||.:..|.:||..||.:..:.:      ||   :.||::.||.. 
Mouse     9 GSGS-----LDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAA------DW---TLLAEEMGFEYL 59

  Fly   129 -----ENANNPMDLVLISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQRFIMKQEQ 188
                 |...:|...:|.:|..||  .|.||.|...|.::||.|:..:::..:.:|.|:::.||:.
Mouse    60 EIRELETRPDPTRSLLDAWQGRS--GASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQN 122

  Fly   189 R------QTALVEACPPPPSDCFETNNNYSSSNNITVGQSVQILSDEDQRCVQMGQPLPRYNACV 247
            :      |.|.||:..|...:               :| .:..|.|      .:||....::|.:
Mouse   123 QESEKPLQVARVESSVPQTKE---------------LG-GITTLDD------PLGQTPELFDAFI 165

  Fly   248 LYAEADIDHATEIMNNLESERYNLRLFLRHRDMLMGVPFEHVQLSHFMATRCNHLIVVLTEEFLR 312
            .|...||:...|::..||...|.|:|.:..||:|.|.....: .|..:..||..::||:::::|:
Mouse   166 CYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSI-ASELIEKRCRRMVVVVSDDYLQ 229

  Fly   313 SPENTYLVNFTQKIQIENHTRKIIPILYKT-DMHIPQTLGIYTHIKYAGDSKLFNFWDKLARSL 375
            |.|..:...|...:......:::|||.||. ....|..|...|...|........||.:||::|
Mouse   230 SKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKAL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326 25/87 (29%)
TIR_2 242..375 CDD:304906 36/133 (27%)
Myd88NP_034981.1 Death_MyD88 29..106 CDD:260026 23/82 (28%)
Intermediate domain 110..155 9/50 (18%)
TIR 161..296 CDD:214587 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849998
Domainoid 1 1.000 45 1.000 Domainoid score I12179
eggNOG 1 0.900 - - E1_28PXY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5081
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006849
OrthoInspector 1 1.000 - - oto95212
orthoMCL 1 0.900 - - OOG6_108536
Panther 1 1.100 - - LDO PTHR15079
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5112
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.