DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and TOLL1A

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_309197.1 Gene:TOLL1A / 1270495 VectorBaseID:AGAP001004 Length:1152 Species:Anopheles gambiae


Alignment Length:205 Identity:53/205 - (25%)
Similarity:82/205 - (40%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YNACVLYAEADIDHATE-IMNNLESERYNLRLFLRHRDMLMGVPFEHV--QLSHFMATRCNHLIV 304
            |:|.|.|:..|....|| ::..||.:..|.:|....||.   .|.|.:  |:|. ...:....|:
Mosquito   897 YDAFVSYSHKDEAFITEHLVPTLERDPMNFKLCWHVRDW---TPGEMISSQISS-SVEQSRRTII 957

  Fly   305 VLTEEFLRSPENTYLVNF-TQKIQ--IENHTRKIIPI------LYKTDMHIPQTLGIYTHIKYAG 360
            ||:..||.|....  :.| |..:|  .|...|.||.|      :|..:..:...|...|:::: |
Mosquito   958 VLSSSFLESLWGQ--LEFRTAHLQSMAERRNRLIIIIYGDIGNIYDLEPELRAYLHTNTYVRW-G 1019

  Fly   361 DSKLFNFWDKLARSL-HD---LDAFSIYST--------------RQVQTPSPVEE---------- 397
            |..   |||||..:: |.   ..|....||              :|:|..:||::          
Mosquito  1020 DPW---FWDKLRFAMPHPPKVRGASGTASTVVKSGVSTAGGLFMKQLQGAAPVDDRLELIKPQVT 1081

  Fly   398 --SAPRVTTP 405
              :.|.:|||
Mosquito  1082 PATPPALTTP 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 41/143 (29%)
TOLL1AXP_309197.1 LRR_8 <153..193 CDD:290566
leucine-rich repeat 163..184 CDD:275380
LRR_RI <176..412 CDD:238064
leucine-rich repeat 185..207 CDD:275380
LRR_8 206..266 CDD:290566
leucine-rich repeat 208..231 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_8 254..311 CDD:290566
leucine-rich repeat 256..279 CDD:275380
leucine-rich repeat 280..353 CDD:275380
leucine-rich repeat 304..329 CDD:275380
LRR_8 328..388 CDD:290566
leucine-rich repeat 330..351 CDD:275380
LRR_RI 351..580 CDD:238064
leucine-rich repeat 354..377 CDD:275380
LRR_8 378..436 CDD:290566
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 426..449 CDD:275380
leucine-rich repeat 450..468 CDD:275380
LRR_8 506..565 CDD:290566
leucine-rich repeat 507..530 CDD:275380
leucine-rich repeat 549..576 CDD:275380
LRRNT 666..702 CDD:214470
leucine-rich repeat 691..734 CDD:275380
LRR_8 709..767 CDD:290566
leucine-rich repeat 735..756 CDD:275380
TIR 897..1034 CDD:214587 41/146 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.