DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myd88 and il18rap

DIOPT Version :9

Sequence 1:NP_001260821.1 Gene:Myd88 / 35956 FlyBaseID:FBgn0033402 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_002934549.3 Gene:il18rap / 100491212 XenbaseID:XB-GENE-480054 Length:564 Species:Xenopus tropicalis


Alignment Length:155 Identity:33/155 - (21%)
Similarity:68/155 - (43%) Gaps:29/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YNACVLYAEADID--------------HATEIMNNLESERYNLRLFLRHRDMLMGVPFEHVQLSH 293
            ::|.|.||:.:.|              .||:.:.::..::|:.:|.|..||:|.|..:  |:...
 Frog   397 FDAFVSYAKHNSDFHEETFEDSHDEEVFATQFLPSVLEDKYHFKLCLLERDILPGGAY--VEDVV 459

  Fly   294 FMATRCNHLIVVLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPIL---YKTDMHIP----QTLG 351
            .:..|...||.:|::.::.|| :.:.:.......:|....|:|.|.   :|....:|    :.|.
 Frog   460 KIIKRSRRLIAILSQRYITSP-SVFELQAAITCTLEEEPIKLILIQLSPFKEPKSLPHIVKKALN 523

  Fly   352 IYTHIKYAGDSKL-----FNFWDKL 371
            ....:::.|:|..     ..||:|:
 Frog   524 ALPTVEWKGNSDYSPSIDTKFWNKV 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myd88NP_001260821.1 DD 90..172 CDD:301326
TIR_2 242..375 CDD:304906 33/155 (21%)
il18rapXP_002934549.3 Ig 33..120 CDD:416386
Ig strand A' 37..41 CDD:409353
Ig strand B 45..50 CDD:409353
Ig strand C 64..70 CDD:409353
Ig strand C' 79..81 CDD:409353
Ig_6 85..128 CDD:408247
Ig strand D 88..92 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 107..115 CDD:409353
Ig <160..225 CDD:416386
Ig strand C 163..168 CDD:409353
Ig strand C' 171..173 CDD:409353
Ig strand D 178..182 CDD:409353
Ig strand E 187..192 CDD:409353
Ig strand F 201..210 CDD:409353
Ig strand G 213..225 CDD:409353
Ig 234..339 CDD:416386
Ig strand A 234..237 CDD:409353
Ig strand A' 245..249 CDD:409353
Ig strand B 251..260 CDD:409353
Ig strand C 269..274 CDD:409353
Ig strand C' 282..284 CDD:409353
Ig strand D 292..300 CDD:409353
Ig strand F 321..327 CDD:409353
Ig strand G 331..337 CDD:409353
TIR 415..552 CDD:396246 28/137 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.