DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and cidec

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001038512.1 Gene:cidec / 564304 ZFINID:ZDB-GENE-030131-4591 Length:239 Species:Danio rerio


Alignment Length:77 Identity:26/77 - (33%)
Similarity:49/77 - (63%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTV 141
            ||.::.:|.|:::||::....|:|..:..|...:....  .:||:.|||.|:..::|:||.:|||
Zfish    38 RPFRVINSDRSIKKGIMADDLEDLHHKVMDVFHIHCIS--ALVLDEDGTGIDTQDFFQTLKDNTV 100

  Fly   142 LLLLRQGERWYP 153
            |::|.:|::|.|
Zfish   101 LMVLGKGQKWAP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 24/74 (32%)
cidecNP_001038512.1 CIDE_N_FSP27 36..114 CDD:119371 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.