DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and cideb

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001243186.1 Gene:cideb / 553467 ZFINID:ZDB-GENE-080514-2 Length:208 Species:Danio rerio


Alignment Length:79 Identity:30/79 - (37%)
Similarity:46/79 - (58%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KRPLKIWDSW-RNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANN 139
            :||.::. || |.|:||:..||.|||..|....|.:  |:.:.:|.|.|||:::..|:...|.:|
Zfish    20 QRPFRVC-SWNREVKKGITAGTLEELKERAGQALLI--SKMLTLVCEEDGTEVDSDEFLIALPDN 81

  Fly   140 TVLLLLRQGERWYP 153
            ||.:.|:..|.|.|
Zfish    82 TVFMCLQPEEIWKP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 28/76 (37%)
cidebNP_001243186.1 CIDE-N 20..93 CDD:280235 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.