DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and Cidec

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001019504.2 Gene:Cidec / 500292 RGDID:1562113 Length:248 Species:Rattus norvegicus


Alignment Length:130 Identity:42/130 - (32%)
Similarity:69/130 - (53%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTL 136
            |:...||.::..:.|.||||::..:.|:||.:.:|.|.: ..:|..:|||.|||.:|..|||:.|
  Rat    48 ETPRARPCRVSTADRKVRKGIMAHSLEDLLGKVQDILKL-KDKPFSLVLEEDGTIVETEEYFQAL 111

  Fly   137 ANNTVLLLLRQGERW-YPTGVDVIKAAISAIPKIVCETIHALELHDETPSWKIMDNKGRVTVVLH 200
            ..:||.::|::|::| .|:.....||.:|...|               |:.||  :..|||..|:
  Rat   112 PRDTVFMVLQKGQKWKSPSEQRKKKAQLSLSQK---------------PTKKI--DVARVTFDLY 159

  Fly   201  200
              Rat   160  159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 29/76 (38%)
CidecNP_001019504.2 CIDE_N 51..130 CDD:295353 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353190
Domainoid 1 1.000 58 1.000 Domainoid score I10572
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9088
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.