DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and cideb

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001011434.1 Gene:cideb / 496919 XenbaseID:XB-GENE-964767 Length:219 Species:Xenopus tropicalis


Alignment Length:104 Identity:36/104 - (34%)
Similarity:61/104 - (58%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PSS---SVTNGG------LSAMESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASE 114
            |:|   ||::.|      :....|..:||.::.:..|.||:||..|:..||:.|..|.|.:  |.
 Frog     9 PTSFIRSVSSVGSEISRRVKTASSPPQRPFRVCNHDRTVRRGVTAGSLRELIARAMDALFL--SG 71

  Fly   115 PVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWYP 153
            .|.:|||.||||::..::|.||.:.:|:::|.:|::|.|
 Frog    72 VVSLVLEDDGTQLDREDFFETLEDGSVVMVLEKGQKWMP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 28/75 (37%)
cidebNP_001011434.1 CIDE_N 34..114 CDD:383014 30/79 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10291
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9502
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.