DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and cidec

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_012816408.1 Gene:cidec / 493464 XenbaseID:XB-GENE-964503 Length:248 Species:Xenopus tropicalis


Alignment Length:95 Identity:34/95 - (35%)
Similarity:61/95 - (64%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSSVTNGGLSAMESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDG 124
            |:|:|...||...|: .||.::.:|.|::|||:|..:.|:|:.:.:|.|.:  .|.:.:||:.||
 Frog    35 SASMTQQLLSRPVSK-PRPFRVCNSNRSLRKGIVANSLEDLINKTQDALLM--LEAITLVLDEDG 96

  Fly   125 TQIEDGEYFRTLANNTVLLLLRQGERWYPT 154
            |.::..|:||:|.:..|.:.|.:|::|.||
 Frog    97 TCVDTEEFFRSLDDGAVFMALAKGQKWKPT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 25/75 (33%)
cidecXP_012816408.1 CIDE_N 49..127 CDD:383014 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9502
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.