powered by:
Protein Alignment Drep2 and dffa
DIOPT Version :9
Sequence 1: | NP_001097238.1 |
Gene: | Drep2 / 35955 |
FlyBaseID: | FBgn0028408 |
Length: | 549 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002631.1 |
Gene: | dffa / 436904 |
ZFINID: | ZDB-GENE-040718-376 |
Length: | 305 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 29/75 - (38%) |
Similarity: | 41/75 - (54%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 RPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTV 141
:|.|:.:..|....|:.|.:.::|.::|.:.||...|..|.||||.|||.:||..||..|..||.
Zfish 5 KPCKVCNVSRQKCYGLAVTSLDQLRIKGAESLGFCPSASVSVVLENDGTIVEDEAYFMCLPANTK 69
Fly 142 LLLLRQGERW 151
.:||...|.|
Zfish 70 FMLLDANEIW 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Drep2 | NP_001097238.1 |
CIDE-N |
76..152 |
CDD:280235 |
29/75 (39%) |
dffa | NP_001002631.1 |
CIDE_N |
3..81 |
CDD:295353 |
29/75 (39%) |
DFF-C |
87..237 |
CDD:286165 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I11378 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm6535 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12306 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4920 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.040 |
|
Return to query results.
Submit another query.