DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and DFFA

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_004392.1 Gene:DFFA / 1676 HGNCID:2772 Length:331 Species:Homo sapiens


Alignment Length:148 Identity:43/148 - (29%)
Similarity:59/148 - (39%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GGAGVGGGAITTGPSSSVTNGGLSAMESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGV 110
            |.|||        |.|.         |.|..:|..:..::...:.||.....|:|..:..|.|.:
Human     5 GDAGV--------PESG---------EIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAI 52

  Fly   111 PAS-EPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWYPTGVDVIKAAISAIPKIVCETI 174
            ..| .||.:||..|||.::|.:||..|.:||..:.|...|:|.....|...|.||.      |:.
Human    53 DKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQ------ESF 111

  Fly   175 HALELHDETPS-----WK 187
            ..    |||.|     ||
Human   112 DV----DETDSGAGLKWK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 23/76 (30%)
DFFANP_004392.1 CIDE_N 18..96 CDD:295353 24/77 (31%)
DFF-C 100..264 CDD:286165 11/36 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.