DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and Cidec

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001359193.1 Gene:Cidec / 14311 MGIID:95585 Length:249 Species:Mus musculus


Alignment Length:144 Identity:45/144 - (31%)
Similarity:74/144 - (51%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSSVTNGGLSAMESR---GKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLE 121
            |::|....|.:..||   ..||.::..:.|.||||::..:.|:||.:.:|.|.: ..:|..:|||
Mouse    33 STAVVTQQLVSKPSRETPRARPCRVSTADRKVRKGIMAHSLEDLLNKVQDILKL-KDKPFSLVLE 96

  Fly   122 CDGTQIEDGEYFRTLANNTVLLLLRQGERWYPTGVDVIKAAISAIPKIVCETIHALELHDETPSW 186
            .|||.:|..|||:.||.:|:.::|.:|::|.|......|.|..|:              .:.|:.
Mouse    97 EDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQRKKRAQLAL--------------SQKPTK 147

  Fly   187 KIMDNKGRVTVVLH 200
            ||  :..|||..|:
Mouse   148 KI--DVARVTFDLY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 28/75 (37%)
CidecNP_001359193.1 CIDE_N 51..130 CDD:383014 30/79 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849547
Domainoid 1 1.000 58 1.000 Domainoid score I10791
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.