DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and Cidea

DIOPT Version :10

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_031728.2 Gene:Cidea / 12683 MGIID:1270845 Length:217 Species:Mus musculus


Alignment Length:77 Identity:28/77 - (36%)
Similarity:50/77 - (64%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTV 141
            ||.::.:..|:.|:||:..:.:||:.:..|.| |..:..|.:|||.|||.::..|:|:||.:||.
Mouse    35 RPFRVSNHDRSSRRGVMASSLQELISKTLDVL-VITTGLVTLVLEEDGTVVDTEEFFQTLRDNTH 98

  Fly   142 LLLLRQGERWYP 153
            .::|.:|::|.|
Mouse    99 FMILEKGQKWTP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CAD 77..151 CDD:128562 26/73 (36%)
CideaNP_031728.2 CIDE_N_A 33..110 CDD:119372 27/75 (36%)
Amphipathic helix. /evidence=ECO:0000269|PubMed:26609809 163..180
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.