DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Drep2 and CIDEA

DIOPT Version :9

Sequence 1:	NP_001097238.1	Gene:	Drep2 / 35955	FlyBaseID:	FBgn0028408	Length:	549	Species:	Drosophila melanogaster
Sequence 2:	NP_001305312.1	Gene:	CIDEA / 1149	HGNCID:	1976	Length:	253	Species:	Homo sapiens

Alignment Length:	140	Identity:	43/140 - (30%)
Similarity:	69/140 - (49%)	Gaps:	31/140 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 AAGGAGVGGGAIT-----TGPSSS----VTNGG----------LSAMESRGK-----------RP 78
            |:||.|...|:..     .|||..    ...||          |:.|.|:.|           ||
Human     6 ASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARP 70

  Fly    79 LKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLL 143
            .::.:..|:.|:||:..:.:||:.:..|.| |.|:..|.:|||.|||.::..|:|:||.:||..:
Human    71 FRVSNHDRSSRRGVMASSLQELISKTLDAL-VIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFM 134

  Fly   144 LLRQGERWYP 153
            :|.:|::|.|
Human   135 ILEKGQKWMP 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Drep2	NP_001097238.1	CIDE-N	76..152	CDD:280235	28/86 (33%)
CIDEA	NP_001305312.1	CIDE_N_A	67..144	CDD:119372	28/77 (36%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165159177
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm41255
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR12306
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4920
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	5	4.970