DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep2 and cidea

DIOPT Version :9

Sequence 1:NP_001097238.1 Gene:Drep2 / 35955 FlyBaseID:FBgn0028408 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_003201313.1 Gene:cidea / 100536460 ZFINID:ZDB-GENE-091204-339 Length:205 Species:Danio rerio


Alignment Length:78 Identity:23/78 - (29%)
Similarity:42/78 - (53%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTV 141
            ||.|:....|..|||....:..:|:.:......: |.:.:.:|||.|||.::...:|::|..||.
Zfish    34 RPYKVCTPNRRRRKGFTATSLADLVEQVASSFLI-ACQMLTLVLEDDGTVVDSEAFFQSLPTNTP 97

  Fly   142 LLLLRQGERWYPT 154
            .::|.:|:.|.|:
Zfish    98 FMVLEKGDVWTPS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep2NP_001097238.1 CIDE-N 76..152 CDD:280235 21/74 (28%)
cideaXP_003201313.1 CIDE-N 33..108 CDD:280235 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595275
Domainoid 1 1.000 53 1.000 Domainoid score I11378
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.