DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and PRKCQ

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_005252553.1 Gene:PRKCQ / 5588 HGNCID:9410 Length:740 Species:Homo sapiens


Alignment Length:339 Identity:157/339 - (46%)
Similarity:230/339 - (67%) Gaps:11/339 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1161 KQPPNAGM-LSMDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKR 1224
            |:.|:..: |.:::|.|..:||:|.||||.|::.:..||::|||||||..::..|:||..:.|||
Human   400 KERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKR 464

  Fly  1225 IFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHT-DVFLEPRAVFYAACVVLGLQ 1288
            :..:  |..||||.:::..|||::::.|||||..|||||.||.: ..|...||.||||.::||||
Human   465 VLSL--AWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQ 527

  Fly  1289 YLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGD-RTGTFCGTPEFLAPEVLTETSYT 1352
            :||...|:||||||||:|||.:|::||||||:|||.| .|| :|.||||||:::|||:|....|.
Human   528 FLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENM-LGDAKTNTFCGTPDYIAPEILLGQKYN 591

  Fly  1353 RAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRL 1417
            .:||||..|||::|||:|:|||.|.||||:|.||..|...|||:|..||..::.:|..:.||:||
Human   592 HSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRL 656

  Fly  1418 GSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRH 1482
            |.    ..|:::...||.|.|::|..:::.|||.|.:....|.||||:||.:||.:|: ..:...
Human   657 GV----RGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLS-FADRAL 716

  Fly  1483 LTEEEQLLFQDFSY 1496
            :...:|.:|::||:
Human   717 INSMDQNMFRNFSF 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 154/325 (47%)
S_TKc 1174..1433 CDD:214567 131/260 (50%)
PRKCQXP_005252553.1 C1_1 194..246 CDD:278556
C1_1 266..318 CDD:278556
STKc_nPKC_theta 408..738 CDD:270770 155/331 (47%)
S_TKc 414..668 CDD:214567 131/260 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0694
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.