DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and PRKCH

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:NP_006246.2 Gene:PRKCH / 5583 HGNCID:9403 Length:683 Species:Homo sapiens


Alignment Length:400 Identity:175/400 - (43%)
Similarity:246/400 - (61%) Gaps:25/400 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1105 NQYELNVAKAAAAASV----YSPSSSTTSNSNQQQQQQRRNVARGLQYRESGGLETGRAGKQPPN 1165
            |..||  ||..|...:    .||:|...|.|..::|.:..:       :|..|:....:.:    
Human   298 NAVEL--AKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESS-------KEGNGIGVNSSNR---- 349

  Fly  1166 AGMLSMDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVAN 1230
               |.:|||..:.|||:|.||||:|::::.....||:|.|||..|:..|:||..::||||..:|.
Human   350 ---LGIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLAR 411

  Fly  1231 AMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIH-TDVFLEPRAVFYAACVVLGLQYLHENK 1294
              .||||..|:.||||...:.||||:..|||||.||. :..|.|.||.||||.::..|.:||:..
Human   412 --NHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKG 474

  Fly  1295 IIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWG 1359
            ||||||||||:|||.||:.|:||||:||||:..|..|.||||||:::|||:|.|..|..|||||.
Human   475 IIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWA 539

  Fly  1360 LGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDA 1424
            :|||::|||.|.:||..::|:::|::|:||||.||.:|..:|..:::..:.|||..||||..:..
Human   540 MGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGG 604

  Fly  1425 ED-VKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQ 1488
            |. :.:..||:.|.|..|..|:::|||.|.|...|||||||.:|..|:..|||..| .||....|
Human   605 EHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE-GHLPMINQ 668

  Fly  1489 LLFQDFSYTA 1498
            ..|::|||.:
Human   669 DEFRNFSYVS 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 158/326 (48%)
S_TKc 1174..1433 CDD:214567 127/260 (49%)
PRKCHNP_006246.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..225 CDD:278556
C1_1 246..298 CDD:278556 175/399 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..342 5/28 (18%)
S_TKc 355..614 CDD:214567 127/260 (49%)
STKc_nPKC_eta 359..681 CDD:270742 157/322 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0694
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.