DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and PRKCA

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:NP_002728.2 Gene:PRKCA / 5578 HGNCID:9393 Length:672 Species:Homo sapiens


Alignment Length:368 Identity:167/368 - (45%)
Similarity:231/368 - (62%) Gaps:25/368 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1150 ESGGLE---------TGRAG----------KQPP-NAGMLSMDNFRLLSVLGRGHFGKVILSQLR 1194
            |.|.:|         .|.||          |||. |...:.:.:|..|.|||:|.||||:|:..:
Human   295 EEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRK 359

  Fly  1195 SNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAG 1259
            ...:.||||.|||..:|..|:||..:.|||:..:.:  :.|||..|:|||||...:.|||||..|
Human   360 GTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLD--KPPFLTQLHSCFQTVDRLYFVMEYVNG 422

  Fly  1260 GDLMMHI-HTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKE 1323
            ||||.|| ....|.||:||||||.:.:||.:||:..||||||||||::||:||::||||||:|||
Human   423 GDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKE 487

  Fly  1324 GMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVN 1388
            .|..|..|.||||||:::|||::....|.::||||..|||::|||.|:.||.|:||:|:|.||:.
Human   488 HMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIME 552

  Fly  1389 DEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPT 1453
            ..|.||:.||.||::|.:.|:.|:|.:|||.......||::.||||.|.|:.|..|:::|||.|.
Human   553 HNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617

  Fly  1454 INHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSY 1496
            :.. :...|||:.||..:..|||| :...:...:|..|:.|||
Human   618 VCG-KGAENFDKFFTRGQPVLTPP-DQLVIANIDQSDFEGFSY 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 157/324 (48%)
S_TKc 1174..1433 CDD:214567 132/259 (51%)
PRKCANP_002728.2 C1_1 37..89 CDD:278556
C1_1 102..154 CDD:278556
C2_PKC_alpha_gamma 159..289 CDD:175992
STKc_cPKC_alpha 328..668 CDD:270766 158/335 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.