DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and Pkc53E

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster


Alignment Length:331 Identity:166/331 - (50%)
Similarity:220/331 - (66%) Gaps:6/331 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1168 MLSMDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAM 1232
            |:...:|..:.|||:|.||||:|::.:.:.:.||||.|||..||..|:||..:.|||:  :|...
  Fly   344 MIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRV--LALGE 406

  Fly  1233 RHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHT-DVFLEPRAVFYAACVVLGLQYLHENKII 1296
            :.||||.|:|||||...:.|||||..|||||..|.. ..|.||.||||||.:..||.:||...|:
  Fly   407 KPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGIL 471

  Fly  1297 YRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDR-TGTFCGTPEFLAPEVLTETSYTRAVDWWGL 1360
            ||||||||:|||.:|:|||||||:|||.: .||: |.||||||:::|||::....|.::||||..
  Fly   472 YRDLKLDNVLLDADGHVKIADFGMCKENI-VGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAY 535

  Fly  1361 GVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAE 1425
            |||::|||||:.||.|:||||:|.:|.:..|.||:.||.||....:..|.|.|.:|||......|
  Fly   536 GVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEE 600

  Fly  1426 DVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLL 1490
            ||:...|||.|.|:.:..|:|:|||.|.|.|.:||||||::|||||..|| |.:...:...:|..
  Fly   601 DVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLT-PTDKVFMMNLDQSE 664

  Fly  1491 FQDFSY 1496
            |..|||
  Fly   665 FVGFSY 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 165/325 (51%)
S_TKc 1174..1433 CDD:214567 133/260 (51%)
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 164/322 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27201at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.