DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pkn and F48G7.10

DIOPT Version :9

Sequence 1:	NP_001097237.1	Gene:	Pkn / 35950	FlyBaseID:	FBgn0020621	Length:	1501	Species:	Drosophila melanogaster
Sequence 2:	NP_503273.1	Gene:	F48G7.10 / 185998	WormBaseID:	WBGene00018621	Length:	168	Species:	Caenorhabditis elegans

Alignment Length:	114	Identity:	23/114 - (20%)
Similarity:	43/114 - (37%)	Gaps:	25/114 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   433 LSTSPA---PVTYTSLQSGQAGILGGKPYQSVSSL-GRCASV-------TGKLEVRLLGCQ---- 482
            :||.|.   |.....|...:...:.|..:::.:.: ..|.::       .||...|.|||:
Worm     1 MSTEPQFENPFIDRQLDGSKIHEISGHRFKATALVQPTCCAICSKLIYGLGKQGYRCLGCETVVH 65

  Fly   483 ----DLLED----VPGRSRR--DKDNNSSPGDLRSFVKGVTSRSSSKSY 521
                .|:.|    .|...|:  .::.:|..|:||..:...|....|.::
Worm    66 KRCHSLINDRCNFGPSSPRQPPPQELSSDSGELRHRIPSPTEPQVSTNH 114

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pkn	NP_001097237.1	HR1_PKN_1	131..194	CDD:212012
		HR1_PKN_2	243..309	CDD:212013
		HR1_PKN_3	340..414	CDD:212015
		C2	530..611	CDD:301316
		STKc_PKN	1174..1499	CDD:270741
		S_TKc	1174..1433	CDD:214567
F48G7.10	NP_503273.1	C1_1	27..76	CDD:278556	9/48 (19%)
F48G7.10	NP_503273.1	C1_1	114..166	CDD:278556	0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0694
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900