DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and rskra

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_005157500.1 Gene:rskra / 101883587 ZFINID:ZDB-GENE-130103-8 Length:427 Species:Danio rerio


Alignment Length:328 Identity:95/328 - (28%)
Similarity:169/328 - (51%) Gaps:31/328 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1173 NFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFL 1237
            :.::|..:.:|.||.::..:..|..:.||:|.|.|..::....::.  |::.:. :...:|||||
Zfish    90 DLQILGFIAKGSFGPILKVKDVSKEETYAVKVLPKAAVLRHGVLQQ--SKEEVI-IQRQVRHPFL 151

  Fly  1238 VNLYSCFQTEQHVCFVMEYAAGGDLMMH-IHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLK 1301
            ::|..|:|::.::..:.:|.:.|||..: ....:|.|.....:||.:...|.:||...||:||:|
Zfish   152 LSLRDCWQSQSNLFIMCDYCSTGDLYTYWTLKGLFEETDVRVFAAELGSALGFLHNFGIIHRDVK 216

  Fly  1302 LDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFE 1366
            ::|:||..:|::::.||||.:. :..|:|..|.|||.:::|||||:...|:.|.|||.||:|::.
Zfish   217 MENILLTDKGHLRLTDFGLSRR-LERGERAFTICGTIQYMAPEVLSGGPYSHAADWWSLGILLYA 280

  Fly  1367 MLVGESPFPGDDEEEVFDSIVNDEV-RYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQ 1430
            :..||.|...:.:..|..|.|::.: ..|..||.....::..||.|.|.|||    |..|..:..
Zfish   281 LATGEFPLAAEVDHAVMLSRVSEGLYEMPVSLSPALAFLLIELLCKIPTRRL----RCLEHFQSH 341

  Fly  1431 AFFRSIVWDDLLLRKVKP--PFVPTINH------------LEDVSNFDEEFTSEKAQLTPPKEPR 1481
            .||..:.:|..||:: .|  |.:....|            |:.:.||:.:.      |..|..|.
Zfish   342 KFFHGMSFDSQLLQR-NPIEPILALKTHPDLRERSMRGLSLDLLQNFECDL------LNSPSTPT 399

  Fly  1482 HLT 1484
            .|:
Zfish   400 DLS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 95/327 (29%)
S_TKc 1174..1433 CDD:214567 80/260 (31%)
rskraXP_005157500.1 S_TKc 92..344 CDD:214567 80/259 (31%)
STKc_AGC 97..344 CDD:270693 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0694
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.