DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkn and prkch

DIOPT Version :9

Sequence 1:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_002939521.2 Gene:prkch / 100151731 XenbaseID:XB-GENE-486685 Length:691 Species:Xenopus tropicalis


Alignment Length:416 Identity:176/416 - (42%)
Similarity:246/416 - (59%) Gaps:52/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1108 ELNVAKAAAAASV--------------------YSPSSSTTSNSNQQQQQQRRNVARGLQYRESG 1152
            |.|||......||                    :|.|.|..|:||..::....|.:.  ||:   
 Frog   287 EANVAHNCGVNSVDLANALAGMGLHPGNIPFKQHSVSGSVDSDSNHLEEDSISNTSS--QYK--- 346

  Fly  1153 GLETGRAGKQPPNAGMLSMDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVE 1217
                            ..:|:|..|.|||:|.||||:|::.:.::..||:|.|||..|:..|:||
 Frog   347 ----------------FGIDDFTFLRVLGKGSFGKVMLAKSKESDSLYAVKVLKKDVILQDDDVE 395

  Fly  1218 SLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIH-TDVFLEPRAVFYAA 1281
            ..::||||..:  |..||||..|:.||||...:.||||:..|||||.||. :..|.|.||.||:|
 Frog   396 CTMTEKRILSL--ACNHPFLTQLFCCFQTLDRLFFVMEFVNGGDLMFHIQKSRRFDEARACFYSA 458

  Fly  1282 CVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVL 1346
            .:...|.:||:..:|||||||||:|||.||:.|:||||:||||:..|..|.||||||:::|||:|
 Frog   459 EITSALMFLHDKGVIYRDLKLDNVLLDHEGHCKLADFGMCKEGIREGCTTSTFCGTPDYIAPEIL 523

  Fly  1347 TETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRK 1411
            .|..|...||||.:|||::|||.|.:||..::|:::|::|:||||.||.:||.:|:.:::..::|
 Frog   524 QEMQYGPLVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPGWLSQDAVEILQAFMKK 588

  Fly  1412 NPERRLGSSERDAED-VKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLT 1475
            .|.:||||.....|. :....||:.|.||:|..:.::|||.|.|...|||||||.||..|.|.||
 Frog   589 KPAKRLGSLSLGGEKAILWHPFFKDINWDELNKKTIEPPFRPRIKAREDVSNFDPEFIKEDAVLT 653

  Fly  1476 PPKE---PRHLTEEEQLLFQDFSYTA 1498
            |..|   |  |..:|:  |::|||||
 Frog   654 PIDESLLP--LINQEE--FRNFSYTA 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 160/330 (48%)
S_TKc 1174..1433 CDD:214567 125/260 (48%)
prkchXP_002939521.2 C2_PKC_epsilon 7..139 CDD:175981
C1_1 171..221 CDD:365894
C1_1 245..295 CDD:365894 4/7 (57%)
STKc_nPKC_eta 356..678 CDD:270742 158/326 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.