DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hig and APOH

DIOPT Version :9

Sequence 1:NP_724773.1 Gene:hig / 35949 FlyBaseID:FBgn0010114 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_000033.2 Gene:APOH / 350 HGNCID:616 Length:345 Species:Homo sapiens


Alignment Length:270 Identity:79/270 - (29%)
Similarity:105/270 - (38%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 VVVATSTCPQLTE----PLAPLKLRLEGNKLGQRAHYECPEGFRLDGAWNA-TCLASGNWSSPTP 766
            |.:|..|||:..:    .:.|||...|.   |:...|.|..|:...|.... .|..:|.|...|.
Human    16 VAIAGRTCPKPDDLPFSTVVPLKTFYEP---GEEITYSCKPGYVSRGGMRKFICPLTGLWPINTL 77

  Fly   767 TCHAIQCP---RLELDDPHLSLIEL-NTSAWGRAVFKCQWGFKLTGPAQLDCEPSGVWSGPVPRC 827
            .|....||   .||......:..|. ||.:     |.|..||.|.|.....|...|.||..:|.|
Human    78 KCTPRVCPFAGILENGAVRYTTFEYPNTIS-----FSCNTGFYLNGADSAKCTEEGKWSPELPVC 137

  Fly   828 KVIQCVMPVAPLNGRI-------GGTSLSQRRLTVGALVTFSCNDGHSLVGESSIICTENGQWSH 885
            ..|.|..|..|....:       |..||.:      ....|.|...|::.|..:|.||.:|.|:.
Human   138 APIICPPPSIPTFATLRVYKPSAGNNSLYR------DTAVFECLPQHAMFGNDTITCTTHGNWTK 196

  Fly   886 SPPFCKSQCPYPGDPPNGLIAPLKFNYDA------GDYLSVQCRPGFVQSYEGPPERPKCQPDGR 944
            .|...:.:||:|..|.||.:     ||.|      .|..:..|..|:  |.:| ||..:|...|.
Human   197 LPECREVKCPFPSRPDNGFV-----NYPAKPTLYYKDKATFGCHDGY--SLDG-PEEIECTKLGN 253

  Fly   945 WSGPMPKCKS 954
            ||. ||.||:
Human   254 WSA-MPSCKA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
higNP_724773.1 PHA02927 705..952 CDD:222943 77/266 (29%)
CCP 714..768 CDD:153056 15/58 (26%)
CCP <795..828 CDD:153056 11/32 (34%)
CCP 832..891 CDD:153056 16/65 (25%)
Sushi 894..952 CDD:278512 22/63 (35%)
APOHNP_000033.2 CCP 41..260 CDD:332582 69/241 (29%)
Sushi_2 261..345 CDD:312533 1/2 (50%)
Sushi-like 263..345 79/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7190
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.