DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hig and Apoh

DIOPT Version :9

Sequence 1:NP_724773.1 Gene:hig / 35949 FlyBaseID:FBgn0010114 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_001009626.1 Gene:Apoh / 287774 RGDID:1310625 Length:345 Species:Rattus norvegicus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:112/263 - (42%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 VVVATSTCPQLTE-PLA---PLKLRLEGNKLGQRAHYECPEGFRLDGAWNA-TCLASGNWSSPTP 766
            |.:|..|||:..| |.|   |||...:.   |::..|.|..|:...|.... ||..:|.|...|.
  Rat    16 VAIAGRTCPKPDELPFAVVVPLKTFYDP---GEQIVYSCKPGYVSRGGMRRFTCPLTGMWPINTL 77

  Fly   767 TCHAIQCPRLELDDPHLSLIELNTSAWGRAV-FKCQWGFKLTGPAQLDCEPSGVWSGPVPRCKVI 830
            .|....||...:.:.  .::...|..:...: |.|..|:.|.|.:...|...|.||..:|.|..|
  Rat    78 KCIPRVCPFAGILEN--GVVRYTTFEYPNTIGFACNPGYYLNGTSSSKCTEEGKWSPELPVCARI 140

  Fly   831 QCVMPVAPLNGRIGGTSLSQRRLTVG------ALVTFSCNDGHSLVGESSIICTENGQWSHSPPF 889
            .|..|..|     ...:|.:.:.:||      ..|.|.|....::.|..::.||.:|.|:..|..
  Rat   141 TCPPPPIP-----KFAALKEYKTSVGNSSFYQDTVVFKCLPHFAMFGNDTVTCTAHGNWTQLPEC 200

  Fly   890 CKSQCPYPGDPPNGLIAPLKFNYDAGDYLSVQCRP--GFVQSYE-GPPERPKCQPDGRWSGPMPK 951
            .:.:||:|..|.||.:     ||.|...||.:.:.  |..::|: ..||..:|...|.||. :|.
  Rat   201 REVKCPFPSRPDNGFV-----NYPAKPVLSYKDKAVFGCHETYKLDGPEEVECTKTGNWSA-LPS 259

  Fly   952 CKS 954
            ||:
  Rat   260 CKA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
higNP_724773.1 PHA02927 705..952 CDD:222943 72/259 (28%)
CCP 714..768 CDD:153056 18/58 (31%)
CCP <795..828 CDD:153056 10/33 (30%)
CCP 832..891 CDD:153056 15/64 (23%)
Sushi 894..952 CDD:278512 20/60 (33%)
ApohNP_001009626.1 PHA02927 41..260 CDD:222943 61/234 (26%)
Sushi_2 261..345 CDD:401094 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.