DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hig and Apoh

DIOPT Version :9

Sequence 1:NP_724773.1 Gene:hig / 35949 FlyBaseID:FBgn0010114 Length:958 Species:Drosophila melanogaster
Sequence 2:NP_038503.4 Gene:Apoh / 11818 MGIID:88058 Length:345 Species:Mus musculus


Alignment Length:263 Identity:72/263 - (27%)
Similarity:109/263 - (41%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 VVVATSTCPQLTE-PLA---PLKLRLEGNKLGQRAHYECPEGFRLDGAWNA-TCLASGNWSSPTP 766
            |.:|...||:..: |.|   |||...:.   |::..|.|..|:...|.... ||..:|.|...|.
Mouse    16 VAIAGRICPKPDDLPFATVVPLKTSYDP---GEQIVYSCKPGYVSRGGMRRFTCPLTGMWPINTL 77

  Fly   767 TCHAIQCPRLELDDPHLSLIELNTSAWGRAV-FKCQWGFKLTGPAQLDCEPSGVWSGPVPRCKVI 830
            .|....||...:.:.  .::...:..:.:.: |.|..||.|.|.:...|...|.||..:|.|..|
Mouse    78 RCVPRVCPFAGILEN--GIVRYTSFEYPKNISFACNPGFFLNGTSSSKCTEEGKWSPDIPACARI 140

  Fly   831 QCVMPVAP-------LNGRIGGTSLSQRRLTVGALVTFSCNDGHSLVGESSIICTENGQWSHSPP 888
            .|..|..|       .....|..||.|      ..|.|.|....:::|..:::|||.|.|:..|.
Mouse   141 TCPPPPVPKFALLKDYRPSAGNNSLYQ------DTVVFKCLPHFAMIGNDTVMCTEQGNWTRLPE 199

  Fly   889 FCKSQCPYPGDPPNGLIAPLKFNYDAGDYLSVQCRP--GFVQSYE-GPPERPKCQPDGRWSGPMP 950
            ..:.:||:|..|.||.:     ||.|...|..:.:.  |..::|: ..||..:|...|.||. :|
Mouse   200 CLEVKCPFPPRPENGYV-----NYPAKPVLLYKDKATFGCHETYKLDGPEEAECTKTGTWSF-LP 258

  Fly   951 KCK 953
            .|:
Mouse   259 TCR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
higNP_724773.1 PHA02927 705..952 CDD:222943 71/260 (27%)
CCP 714..768 CDD:153056 17/58 (29%)
CCP <795..828 CDD:153056 11/33 (33%)
CCP 832..891 CDD:153056 17/65 (26%)
Sushi 894..952 CDD:278512 19/60 (32%)
ApohNP_038503.4 PHA02927 22..260 CDD:222943 69/254 (27%)
CCP 23..80 CDD:153056 17/59 (29%)
CCP 84..137 CDD:153056 13/54 (24%)
Sushi 142..200 CDD:278512 17/63 (27%)
CCP 205..261 CDD:153056 19/61 (31%)
Sushi_2 261..345 CDD:286149 0/1 (0%)
Sushi-like 263..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7190
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19325
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.