DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP96A14P

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_176777.1 Gene:CYP96A14P / 842916 AraportID:AT1G66030 Length:167 Species:Arabidopsis thaliana


Alignment Length:181 Identity:38/181 - (20%)
Similarity:66/181 - (36%) Gaps:43/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLILWLVGAFIV----LIQWIYRLNRDYCILGFFAKRIRTKN----GQNPESIAPLVKGSTIFAN 57
            |.::.|:.|||.    ||.:.:.:.:.|..:.....:....|    |.:|.::..|.:   |:..
plant     1 MALIGLIEAFIAFVCFLIFYYFLIKKPYSYILIKISQSGLWNWPVLGMSPGALMRLPR---IYDF 62

  Fly    58 SFDLYGKDHSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLH 122
            |.||.  ::|.:..|.:      |..:|      .|..:..|||          :|...|| :..
plant    63 SVDLL--ENSNLTFHFK------GPWFA------GIDILATADS----------VNINHIY-YRG 102

  Fly   123 PFLR-------TGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFITESLK 166
            |.||       .|::.|..:.|...:|.....|:.....:|........||
plant   103 PELREIFGPFGDGIINSDSELWRNLKKATQVIFNHQKYQKFSTSTTRSKLK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 26/120 (22%)
CYP96A14PNP_176777.1 p450 1..>166 CDD:386267 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.