DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP702A1

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:515 Identity:114/515 - (22%)
Similarity:190/515 - (36%) Gaps:139/515 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LILWLVGAFIV-LIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFDLYGKD 65
            |:..:|...:| |..|||                ::||.:..|.:.|...|..|...:|: :.|.
plant     7 LLTVMVSLIVVKLFHWIY----------------QSKNPKPNEKLPPGSMGFPIIGETFE-FMKP 54

  Fly    66 HSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLRTGL- 129
            |..                  :...|.|        .||::.             ..|..||.| 
plant    55 HDA------------------FQFPTFI--------KERIIR-------------YGPIFRTSLF 80

  Fly   130 ----LTST--------GKKWHA--RRKMLSPTFHFNILNQFQEIFITESLKFLE----QFKGNDE 176
                :.||        .|..||  ..|.::..|..|.| .||.   .||.|.:.    |..|:..
plant    81 GAKVIISTDIELNMEIAKTNHAPGLTKSIAQLFGENNL-FFQS---KESHKHVRNLTFQLLGSQG 141

  Fly   177 AIISLNEVIPRFTLNSICETAMGVKLD--EMAEK-----------GDRYRENFRQIEECFIRRMS 228
            ..:|:.:.|...|...:.|.|....||  |::.|           ||...|..:::..|:....|
plant   142 LKLSVMQDIDLLTRTHMEEGARRGCLDVKEISSKILIECLAKKVTGDMEPEAAKELALCWRCFPS 206

  Fly   229 N----PLLWSDT-LFKMFAEKDYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTAEDELFTS 288
            .    ||....| ::||...:.     .::|.....|:.||..  .:|:          .|.|  
plant   207 GWFRFPLNLPGTGVYKMMKARK-----RMLHLLKETILKKRAS--GEEL----------GEFF-- 252

  Fly   289 KKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQE-- 351
            |..|...:|:.:   |..|::|      .||.....:||...|...:..:|..|:..::.::|  
plant   253 KIIFEGAETMSV---DNAIEYI------YTLFLLANETTPRILAATIKLISDNPKVMKELHREHE 308

  Fly   352 --IQANIDDELNILNIGQLNKLKNLEY---FIKETMRLFPSVPAMGRETTRETELSNGLILPKGS 411
              ::...:.|.:|    ...:.|::.:   .|.|::|:..:.|.:.|....|.::.:..| |.| 
plant   309 GIVRGKTEKETSI----TWEEYKSMTFTQMVINESLRITSTAPTVFRIFDHEFQVGSYKI-PAG- 367

  Fly   412 QIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEM 471
            .||:...:.|.||:.:|.|..|.|.|:..::.....:..||||.||.|.|:|.:||..:|
plant   368 WIFMGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVSRTYIPFGAGSRQCVGAEFAKLQM 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 102/462 (22%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 113/514 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.