DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP96A15

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:460 Identity:119/460 - (25%)
Similarity:199/460 - (43%) Gaps:74/460 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GTAIYNVIDADSAERVLNDPNLIN--KGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNI 152
            ||.:....|..:...:|:. |..|  ||..:..:...|..|:||...:.|...||.....||   
plant    76 GTDMLFTADPRNIHHILSS-NFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRKSNHALFH--- 136

  Fly   153 LNQ-FQEIFITESLKFLEQ----FKGN---DEAIISLNEVIPRFTL--NSICETA---------- 197
             || |.|:.::.:...|::    |..|   ...||.|.:|..||..  :||..|.          
plant   137 -NQDFIELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQDVFQRFMFDTSSILMTGYDPMSLSIEM 200

  Fly   198 MGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWS-DTLFKMFAEKDYASALDVVHGFSSEII 261
            :.|:..|.|:.|:         |..:.|.....:||. .....:..|:...:||..|:...::||
plant   201 LEVEFGEAADIGE---------EAIYYRHFKPVILWRLQNWIGIGLERKMRTALATVNRMFAKII 256

  Fly   262 AKRRDQLNDEIDSRGNTQTAEDELFTSKKRFAMLDT----LILAEKDGLIDHIGICEEVDTLMFE 322
            :.||   .:|| ||..|:....:..|   .:..:||    |:...||..|..:     :.:|:..
plant   257 SSRR---KEEI-SRAKTEPYSKDALT---YYMNVDTSKYKLLKPNKDKFIRDV-----IFSLVLA 309

  Fly   323 GYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPS 387
            |.||||..|.:....:|.:|:...|...||....|:|       .|.||..|...:.|:|||:|.
plant   310 GRDTTSSVLTWFFWLLSKHPQVMAKLRHEINTKFDNE-------DLEKLVYLHAALSESMRLYPP 367

  Fly   388 VPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPEYW-DSPEEFRPERFLPENSQNRH--TY 449
            :|...:...:...|.:|..:...|:|.:.::.:.|....| :...:|:|||::.:|...||  :|
plant   368 LPFNHKSPAKPDVLPSGHKVDANSKIVICIYALGRMRSVWGEDALDFKPERWISDNGGLRHEPSY 432

  Fly   450 AYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQ-----TGLTLRTKNQIHV 509
            .::.|::|.|.|:|:..|:.:||  ||||    :|:...|.|.|...     ..:.||.|:.:.|
plant   433 KFMAFNSGPRTCLGKNLALLQMK--MVAL----EIIRNYDFKVIEGHKVEPIPSILLRMKHGLKV 491

  Fly   510 KLVRR 514
            .:.::
plant   492 TVTKK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 117/449 (26%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 119/460 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.