DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP72C1

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:262 Identity:57/262 - (21%)
Similarity:88/262 - (33%) Gaps:89/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWLVGAFIVLIQWIY-----------RLNRDYCILGFFAKRIRTKNGQNPES-----IA---PLV 49
            ::|:|..|:::.|::           ||.:.....||.....|...|...||     :|   ||.
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLP 74

  Fly    50 KGSTIFANSFDLYGKDHSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVI--DADSAERVLNDPNLI 112
            ..:..........   |..|.:|.:.|.    ..|..|.      |||  |.::...:::...|.
plant    75 LDADFLPRMMPFL---HHTVLKHGKKCF----TWYGPYP------NVIVMDPETLREIMSKHELF 126

  Fly   113 NKGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFITESLKFLEQFKGNDEA 177
            .|..|....|.|| :|||...|.||...|.:|:|.|.                            
plant   127 PKPKIGSHNHVFL-SGLLNHEGPKWSKHRSILNPAFR---------------------------- 162

  Fly   178 IISLNEVIPRFTLNSICE----------TAMG-VKLDE-------------MAEKGDRYRENFRQ 218
            |.:|..::|.|  ||.|:          :|.| ::||.             .|..||.|::..:.
plant   163 IDNLKSILPAF--NSSCKEMLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGDSYKDGIKI 225

  Fly   219 IE 220
            .|
plant   226 FE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 42/193 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.