DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP702A8

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:378 Identity:79/378 - (20%)
Similarity:136/378 - (35%) Gaps:91/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LTSTGKKWHARR---KMLSPTFHFNILNQFQEIFITESLKFLEQF---KGNDEAIISLNEVIPRF 188
            |.||....|.|.   :||.        :|..::.|.|::..|.:.   :|..:..:.:.|...:.
plant    51 LQSTESHKHVRNLTVQMLG--------SQSLKLRIMENIDLLTRTHMEEGARDGSLDVKETTSKI 107

  Fly   189 TLNSICETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFK---------MFAEK 244
            .:..:.:..||....|.|:|          :..|:   ...|..|....|.         |.|.|
plant   108 LIECLAKKVMGEMEPEAAKK----------LALCW---RYFPSGWFRLPFNLPGIGVYNMMKARK 159

  Fly   245 DYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTAEDELFTSKKRFAMLDTLILAEKDG---L 306
            ...:.|      ..|::.||.                      :.:.|.....:|..||:|   .
plant   160 RMKTLL------KEEVLKKRE----------------------AGEEFGEFSKIIFGEKEGEKET 196

  Fly   307 IDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQ-------ANIDDELNILN 364
            :....:.|.:.|......:||...|...:..:|    |..|..||:|       .|..:|..:  
plant   197 MSMKNVIEYIYTFFVIANETTPRILAATVKFIS----ENPKVMQELQREHAMIFENKSEEAGL-- 255

  Fly   365 IGQLNKLKNLEY---FIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPEY 426
              .....|::.:   .|.|::|:..:||.:.|:...:|::.: ..:|.|.. |:.....|.:|..
plant   256 --TWEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVGD-YTIPAGWN-FMGYPSAHFDPTK 316

  Fly   427 WDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALL 479
            ::.|.||.|.|:...:.....:..||||.||.|.|:|..||    |.||...:
plant   317 YEDPLEFNPWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFA----KLLMAIFI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 79/378 (21%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 79/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.