DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP86A8

DIOPT Version :10

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_182121.1 Gene:CYP86A8 / 819205 AraportID:AT2G45970 Length:537 Species:Arabidopsis thaliana


Alignment Length:71 Identity:17/71 - (23%)
Similarity:31/71 - (43%) Gaps:14/71 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 SKALACFLLSLSNVDYPVISQMALDMLARLNANEIILEVL--------------LERGQVIDALR 571
            |:::|....:.||.....|.::|..:...::.|.::||.:              :.|.|...|.|
plant    29 SQSVALTPAAPSNAGRAPIRRVANQIPDEISHNPLLLEAMKVLPENYNFEIPKTIWRIQQASAKR 93

  Fly   572 LAKQMP 577
            :|.|||
plant    94 VALQMP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 CYP4 81..509 CDD:410721
CYP86A8NP_182121.1 CYP86A 67..503 CDD:410687 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.