DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:432 Identity:129/432 - (29%)
Similarity:223/432 - (51%) Gaps:31/432 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 AIYNVIDADSAERVLN--DPNLINKGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILN 154
            |.:.:.|.|.|:..|:  ||.:   ..::..|.|.:..|||...|.:|...|.:|:|.||.:||.
Mouse    89 AFFYIYDPDYAKIFLSRTDPKM---QYLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQDILK 150

  Fly   155 QFQEIFITESLKFL----EQFKGNDEAIISLNEVIPRFTLNSICETAMGVKLD-EMAEKGDRYRE 214
            ...:. :..|:|.:    |:.....|..|.:.|.|...||:.|.:.|.|.:.: ::....:.|.:
Mouse   151 PCVDT-MAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVK 214

  Fly   215 NFRQIEECFIRRMSNPLLW--SDTLFKMFAEKDYASAL-DVVHGFSSEIIAKRRDQLNDEIDSRG 276
            ...::.|....|:.|  .|  .|.:||:..:......| .|:|.::.:||..|:..|.::: .:.
Mouse   215 ATFELGEIISSRLYN--FWHHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQDRKKILKNQV-KQD 276

  Fly   277 NTQTAEDELFTSKKRFAMLDTLI--LAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMS 339
            :|||::          ..||.::  .||.:.......:..||:|.|:.|:|.::..:.:.|..::
Mouse   277 DTQTSQ----------IFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLA 331

  Fly   340 LYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNG 404
            |.||.|::|..||::.:.|..:| ...||:::......||||:||.|.||::.||.::...|.:|
Mouse   332 LNPEHQDRCRTEIRSILGDGSSI-TWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDG 395

  Fly   405 LILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQ 469
            ..||.|..:.:.::.:|.||..|:.|:.|.|.||..|||..||..|::|||:|.||||||:|||.
Mouse   396 HSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAML 460

  Fly   470 EMKTLMVALLKQFQILPEIDPKTIVFQTGLTLRTKNQIHVKL 511
            |:|..:..:|..||:.|:: .:...|.:...||.|:.|::.|
Mouse   461 ELKVAIALILLHFQVAPDL-TRPPAFSSHTVLRPKHGIYLHL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 126/424 (30%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 128/428 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.