DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and BAS1

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_180239.1 Gene:BAS1 / 817212 AraportID:AT2G26710 Length:520 Species:Arabidopsis thaliana


Alignment Length:413 Identity:101/413 - (24%)
Similarity:176/413 - (42%) Gaps:79/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DPNLI----NKGTIYD--FLHPFLR----TGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIF-- 160
            ||:||    :|...|:  ..||.::    .|||:..|:||...||::|||||...|.....:.  
plant   113 DPDLIREIFSKSEFYEKNEAHPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLVPVVLK 177

  Fly   161 -ITESL-KFLEQFKGNDEAIISLNEVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFRQIEECF 223
             :|:.: |:.::...|.|..:.:.|.....|.:.|..||.|              .::......|
plant   178 SVTDMVDKWSDKLSENGEVEVDVYEWFQILTEDVISRTAFG--------------SSYEDGRAVF 228

  Fly   224 IRRMSNPLLWSDTLFKMF-----------------AEKDYASALDVVHGFSSEIIAKRRDQLNDE 271
            ..:....||.::...|:|                 .:|:...:|       .::|.:||   .:.
plant   229 RLQAQQMLLCAEAFQKVFIPGYRFFPTRGNLKSWKLDKEIRKSL-------LKLIERRR---QNA 283

  Fly   272 IDSRG---NTQTAEDELFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMF 333
            ||..|   ....|:|          :|..:|.|:...:.|   |.||..:..|.|..|||..|.:
plant   284 IDGEGEECKEPAAKD----------LLGLMIQAKNVTVQD---IVEECKSFFFAGKQTTSNLLTW 335

  Fly   334 GLMNMSLYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRE 398
            ..:.:|::||.|.|...|: ..:....::.....:.|||.|...:.|::||:|.:.|..|....:
plant   336 TTILLSMHPEWQAKARDEV-LRVCGSRDVPTKDHVVKLKTLSMILNESLRLYPPIVATIRRAKSD 399

  Fly   399 TELSNGLILPKGSQIFVHVFDIHRNPEYW-DSPEEFRPERF---LPENSQNRHTYAYIPFSAGQR 459
            .:| .|..:|.|:::.:.:..:|.:...| :...||.|.||   :|..:  :|...:|||..|.|
plant   400 VKL-GGYKIPCGTELLIPIIAVHHDQAIWGNDVNEFNPARFADGVPRAA--KHPVGFIPFGLGVR 461

  Fly   460 NCIGQKFAMQEMKTLMVALLKQF 482
            .||||..|:.:.|..:..::::|
plant   462 TCIGQNLAILQAKLTLAVMIQRF 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 101/413 (24%)
BAS1NP_180239.1 CYP734 85..509 CDD:410732 101/413 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.