DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and cyp4f2

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:409 Identity:140/409 - (34%)
Similarity:225/409 - (55%) Gaps:24/409 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFITESLKFLEQFKG-NDEAIISL 181
            |.||.|:|..|||.|.|:||...|::|:|.|||:||..:.:||...:...|.:::. ..|..:||
 Frog   132 YGFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILKNYVKIFNQSTDIMLAKWRRLTAEGPVSL 196

  Fly   182 N--EVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFKMFAE- 243
            :  |.:...||:::.:.......| ..||...|.....::....::|........|.::.:.:. 
 Frog   197 DMFEHVSLMTLDTLLKCTFSYDSD-CQEKPSDYISAIYELSSLVVKREHYLPHHFDFIYNLSSNG 260

  Fly   244 KDYASALDVVHGFSSEIIAKRRDQLNDE-----IDSR-GNTQTAEDELFTSKKRFAMLDTLILAE 302
            :.:..|...||.|::.::.:|:..|.::     |.|: |.|:...|.|..||..    |...|::
 Frog   261 RKFRQACKTVHEFTAGVVQQRKKALQEKGMEEWIKSKQGKTKDFIDILLLSKNE----DGSQLSD 321

  Fly   303 KDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANID-DELNILNIG 366
            :|       :..||||.||||:|||:.||.:.|.|::.:||.||||.:||...:: .::..|...
 Frog   322 ED-------MRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWD 379

  Fly   367 QLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDIHRNPEYWDSPE 431
            :|:||......|||::||.|.|.|:.|..|.:.:|..|.|||||:...:::|.||.||:.|.:|:
 Frog   380 ELSKLPFTTMCIKESLRLHPPVVAVIRRCTEDIKLPKGDILPKGNCCIINIFGIHHNPDVWPNPQ 444

  Fly   432 EFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQ 496
            .:.|.||.|||.|.|.:||::|||||.||||||.|||.|||.::..:|..||:..: :.||:..:
 Frog   445 VYDPYRFDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLD-ETKTVRRK 508

  Fly   497 TGLTLRTKNQIHVKLVRRK 515
            ..|.||.:|.:.:::...|
 Frog   509 PELILRAENGLWLQVEELK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 138/397 (35%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 136/393 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.