DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:440 Identity:100/440 - (22%)
Similarity:178/440 - (40%) Gaps:79/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VIDADSAERVLNDPNLINKGTIYDFLH-----PFLRTGLLTSTGKKWHARRKMLSPTFH------ 149
            |::...|:::|...  .||.|...|.|     | |...|....|:||...|..||.||.      
  Fly    85 VLETSLAKQILIKE--FNKFTDRGFFHNPEDDP-LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKY 146

  Fly   150 -----FNILNQFQEIFITESLKFLEQFKGNDEA---IISLNEVIPRFTLNSICETAMGVKLDEMA 206
                 ..:.|:|.::|            |.:.|   ::.:.|::.|||.:.|...|.|::...:.
  Fly   147 MFPTVVKVANEFTDVF------------GQNVAKSPVVEVRELLARFTTDVIGTCAFGIECSSLK 199

  Fly   207 EKGDRYRE-NFRQIEECFIRRM---------SNPLLWSDTLFKMFAEKDYASALDVVH---GFSS 258
            :....:|| ..|.:.|   :|:         |.|.|......||.||......:.:|.   .|..
  Fly   200 DPDAEFREMGRRSLTE---QRLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFRE 261

  Fly   259 EIIAKRRDQLNDEIDSRGN----TQTAEDELFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTL 319
            :...:|.|.::..||.:..    :|:.|....|.::                     |..:....
  Fly   262 QNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEE---------------------IAAQAFVF 305

  Fly   320 MFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRL 384
            ...|::|:|..:.|.|..::...:.|.:..:|.|..|:.....||...:..|..|:..:.||:||
  Fly   306 FAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRL 370

  Fly   385 FPSVPAMGRETTRETELSN--GLILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRH 447
            :..:|.:.||...:.|:..  ..::.||..:.:....:||:.:.:.:|..|.|:.|.||..:.|.
  Fly   371 YTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERD 435

  Fly   448 TYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQT 497
            :..::||..|.|||||.:|...:.:..:..|:|.|:.  .:..||.:..|
  Fly   436 SVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKF--SVCEKTTIPMT 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 100/440 (23%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 100/440 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.