DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:433 Identity:134/433 - (30%)
Similarity:227/433 - (52%) Gaps:42/433 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DADSAERVL--NDPNLINKGTIYDFLHPFLRT----GLLTSTGKKWHARRKMLSPTFHFNILNQF 156
            |.|..:.||  :||   ....||.||.|::.:    |||...||||....:||:|.||:.||..:
  Rat    98 DPDYVKVVLGRSDP---KASGIYQFLAPWIVSGTGYGLLLLNGKKWFQHWRMLTPAFHYGILKPY 159

  Fly   157 QEIFITESLKFLEQFKGNDEA--IISLNEVIPRFTLNSICETAM----GVKLDEMAEKGDRYREN 215
            .:|........|::::..|:.  .:.:...:...||:::.:.|.    .|:||..:..   |.:.
  Rat   160 VKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRS---YTKA 221

  Fly   216 FRQIEECFIRRMSNPLLWSDTLFKMFAEKDYA-SALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQ 279
            ...:......|:.:....:..::.|.::...: .|..:.|..:..:|..|:.||.:         
  Rat   222 VEDLNNLTFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQN--------- 277

  Fly   280 TAEDELFTSKKR--FAMLDTLILAE-KDG--LIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMS 339
              |:||..::|:  ...||.|:.|: :||  |.|. .:..||||.||||:|||:.|:.:....::
  Rat   278 --EEELQKARKKRHLDFLDILLFAKMEDGKSLSDE-DLRAEVDTFMFEGHDTTASGISWVFYALA 339

  Fly   340 LYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNG 404
            .:||.||:|.:|:|:.:.|..:: ....|:::......|||.:||:|.||::.||.:......:|
  Rat   340 THPEHQERCREEVQSILGDGTSV-TWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDG 403

  Fly   405 LILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQ 469
            ..:|||....:.::.:|.||.||.:|:.|.|.||.|::.  ||::||:|||.|.|||||::|||.
  Rat   404 RSIPKGITTTILIYGLHHNPSYWPNPKVFDPSRFSPDSP--RHSHAYLPFSGGARNCIGKQFAMN 466

  Fly   470 EMKTLMVALLKQFQILPEIDPKTI-VFQTGLTLRTKNQIHVKL 511
            |:|..:...|.:|::||  ||..| |....|.|::||.||::|
  Rat   467 ELKVAVALTLLRFELLP--DPTRIPVPMARLVLKSKNGIHLRL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 129/425 (30%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 133/430 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.