DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:434 Identity:137/434 - (31%)
Similarity:226/434 - (52%) Gaps:44/434 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VIDADSAERVL--NDPNLINKGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQE 158
            |.|.|..:.:|  :||...:.   |.||.|::..|||...|:.|...|:||:|.||::.|..:..
  Rat    99 VYDPDYMKLILGRSDPKSHHS---YRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDTLKPYVG 160

  Fly   159 IFITESLKFL----EQFKGNDEAIISLNEVIPRFTLNSICETAM----GVKLDEMAEKGDRYREN 215
            | :.:|::.:    ||..|.| :.:.:.:.|...||::|.:.|.    .|:||.      :|:..
  Rat   161 I-MADSVRIMLDKWEQIVGQD-STLEIFQHITLMTLDTIMKCAFSQEGSVQLDR------KYKSY 217

  Fly   216 FRQIEE----CFIRRMSNPLLWSDTLFKMFAE-KDYASALDVVHGFSSEIIAKRRDQLNDEIDSR 275
            .:.:|:    .|. |:.|....:|.::.:.:. :...||..:.|..:.::|..|:.||.||    
  Rat   218 IKAVEDLNNLSFF-RIRNIFHQNDIIYSLSSNGRKARSAWQLAHEHTDQVIKSRKAQLQDE---- 277

  Fly   276 GNTQTAEDELFTSKKRFAMLDTLILA--EKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNM 338
                 .|.:....|:|...||.|:.|  |....:....:..||||.||||:|||:.|:.:....:
  Rat   278 -----EELQKVKQKRRLDFLDILLFARIENGSSLSDKDLRAEVDTFMFEGHDTTASGISWIFYAL 337

  Fly   339 SLYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSN 403
            :..||.|:.|.:|||:.:.|..:| ....|:|:......|||.:|::|.|.|:.|..:......:
  Rat   338 ATNPEHQQGCRKEIQSLLGDGASI-TWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPD 401

  Fly   404 GLILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAM 468
            |..||||..:.:..:.:|.||..|.:||.|.|.||.||:|  ||:::::|||.|.|||||::|||
  Rat   402 GRSLPKGITVMLSFYGLHHNPTVWPNPEVFDPYRFAPESS--RHSHSFLPFSGGARNCIGKQFAM 464

  Fly   469 QEMKTLMVALLKQFQILPEIDPKTIVFQ-TGLTLRTKNQIHVKL 511
            .|:|..:...|.:|::||  ||..|... ..|.|::||.|:::|
  Rat   465 NELKVAVALTLLRFELLP--DPTRIPIPIPRLVLKSKNGIYLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 133/426 (31%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 136/431 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.