DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p3 and CYP4A11

DIOPT Version :9

Sequence 1:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:441 Identity:137/441 - (31%)
Similarity:231/441 - (52%) Gaps:42/441 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GTAIYNVIDADSAERVL--NDPNLINKGTIYDFLHPFLRTGLLTSTGKKWHARRKMLSPTFHFNI 152
            |.....:.|.|..:.:|  :||.  :.|: |.||.|::..|||...|:.|...|:||:|.||::|
Human    93 GKVRVQLYDPDYMKVILGRSDPK--SHGS-YRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDI 154

  Fly   153 LNQFQEIFITESLKFL----EQFKGNDEAIISLNEVIPRFTLNSICETAM----GVKLDEMAEKG 209
            |..:..: :.:|::.:    |:..|.|.. :.:.:.:...||::|.:.|.    .:::|..::. 
Human   155 LKPYVGL-MADSVRVMLDKWEELLGQDSP-LEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQS- 216

  Fly   210 DRYRENFRQIEECFIRRMSNPLLWSDTLFKMFAEKDYA-SALDVVHGFSSEIIAKRRDQLNDEID 273
              |.:....:......|:.|....:||::.:.:...:. .|..:.|..:.::|..|:.||..|  
Human   217 --YIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKE-- 277

  Fly   274 SRGNTQTAEDELFTSKKRFAMLDTLILA--EKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLM 336
                   .|.|....|:....||.|:||  |...::....:..||||.||||:|||:.|:.:.|.
Human   278 -------GELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILY 335

  Fly   337 NMSLYPEEQEKCYQEIQANIDDELNILNIGQLNKLKNLEY---FIKETMRLFPSVPAMGRETTRE 398
            .::.:|:.||:|.:||.:.:.|..:|    ..|.|..:.|   .|||.:||:|.||.:|||.:..
Human   336 ALATHPKHQERCREEIHSLLGDGASI----TWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTP 396

  Fly   399 TELSNGLILPKGSQIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIG 463
            ....:|..||||..:.:.::.:|.||:.|.:||.|.|.||.|.::|  |::|::|||.|.|||||
Human   397 VTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQ--HSHAFLPFSGGSRNCIG 459

  Fly   464 QKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQTG-LTLRTKNQIHVKLVR 513
            ::|||.|:|......|.:|::||  ||..|..... |.|::||.||::|.|
Human   460 KQFAMNELKVATALTLLRFELLP--DPTRIPIPIARLVLKSKNGIHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 131/431 (30%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 135/436 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.