DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP4F2

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:404 Identity:133/404 - (32%)
Similarity:212/404 - (52%) Gaps:33/404 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LNHPNLITKGVI-------------YNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQ 159
            |.||::| :.||             |:||.|:|..|:|.:...||...|.|||..||.:||..:.
Human   101 LCHPDII-RSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYM 164

  Fly   160 EIFIAESLKFV-SQFQ---GQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHI 220
            :|| .||:..: :::|   .:....:.:.:.||..||:|:.:...... ....||...|.|....
Human   165 KIF-NESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILE 227

  Fly   221 IDEGLTRRIVNPLYWDDCVYNMF-TGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTAD 284
            :...:::|....|...|.:|.:. .|.::..|.::||:|:..:|.:||..|        .:|..|
Human   228 LSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTL--------PSQGVD 284

  Fly   285 DDI-CVIRKKRFAMLDTLICA-EKDG-LIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAA 346
            |.: ...:.|....:|.|:.: ::|| .:.|..|..|.||.|.||:|||:.||.:.|.:::.:..
Human   285 DFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPE 349

  Fly   347 EQELCYQEIQEHILD-DLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLIL 410
            .||.|.||:||.:.| :...:....|:.|.:|...:||::||:|.:|::.|...|:..|.:|.::
Human   350 YQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVI 414

  Fly   411 PKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMK 475
            ||.....|.||..|.||..|..||.:.|.||.|:|..:|.|.|:||||||.||||||.:||.|||
Human   415 PKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMK 479

  Fly   476 TLMVVILKHFKILP 489
            .::.:.|..|::||
Human   480 VVLALTLLRFRVLP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 133/404 (33%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 133/404 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.