DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP96A14P

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_176777.1 Gene:CYP96A14P / 842916 AraportID:AT1G66030 Length:167 Species:Arabidopsis thaliana


Alignment Length:162 Identity:36/162 - (22%)
Similarity:57/162 - (35%) Gaps:49/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LNLSQLSKLNY--LGYFIKETMRLYPSIPIMGRQTLQETELE--------NGL-ILPKRSQINI- 418
            :.:||....|:  ||......||| |.|.......|:.:.|.        .|: ||.....:|| 
plant    33 IKISQSGLWNWPVLGMSPGALMRL-PRIYDFSVDLLENSNLTFHFKGPWFAGIDILATADSVNIN 96

  Fly   419 HVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILK 483
            |::  :|.|:..|                     .:.||..|..|...:.:  :.:|....||..
plant    97 HIY--YRGPELRE---------------------IFGPFGDGIINSDSELW--RNLKKATQVIFN 136

  Fly   484 HFKILPVIDPKSIVFQVGITLRFKNKIKVKLV 515
            |.|           :|...|...::|:|:.||
plant   137 HQK-----------YQKFSTSTTRSKLKLGLV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 34/159 (21%)
CYP96A14PNP_176777.1 p450 1..>166 CDD:386267 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.