DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP702A1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:577 Identity:113/577 - (19%)
Similarity:204/577 - (35%) Gaps:183/577 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWISVAILVV--IHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANCFDLLGKD 67
            ||.:.|:::||  .||||                |:|:.||.:.|.|...|       |.::|: 
plant     7 LLTVMVSLIVVKLFHWIY----------------QSKNPKPNEKLPPGSMG-------FPIIGE- 47

  Fly    68 TDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVI-YNFLHPFLRTG- 130
                                       .|..:..|:|   ...|..|.:.:| |.   |..||. 
plant    48 ---------------------------TFEFMKPHDA---FQFPTFIKERIIRYG---PIFRTSL 79

  Fly   131 ----VLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQGQNEVVVSLKD---RIS 188
                |:.:|:.:.:..   :.:|.|...|.           |.::|..|:|.:....|:   .:.
plant    80 FGAKVIISTDIELNME---IAKTNHAPGLT-----------KSIAQLFGENNLFFQSKESHKHVR 130

  Fly   189 RFTLNSICETAMGIKL--------------DEMAEKG--DRYRANFHIIDEGLTRRIVN------ 231
            ..|...:  .:.|:||              :|.|.:|  |....:..|:.|.|.:::..      
plant   131 NLTFQLL--GSQGLKLSVMQDIDLLTRTHMEEGARRGCLDVKEISSKILIECLAKKVTGDMEPEA 193

  Fly   232 ----PLYWDDC----------------VYNMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELEN 276
                .|.| .|                ||.|....|     :::|            ||:|.:..
plant   194 AKELALCW-RCFPSGWFRFPLNLPGTGVYKMMKARK-----RMLH------------LLKETILK 240

  Fly   277 RRATQTADDDICVIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNM 341
            :||   :.:::....|..|...:|:   ..|..|      |.:.||.....:||...|.   ..:
plant   241 KRA---SGEELGEFFKIIFEGAETM---SVDNAI------EYIYTLFLLANETTPRILA---ATI 290

  Fly   342 SLYAAEQELCYQEIQEH------ILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQ 400
            .|.:...::..:..:||      ..:..:::...:...:.:....|.|::|:..:.|.:.|  :.
plant   291 KLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPTVFR--IF 353

  Fly   401 ETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCI 465
            :.|.:.|........|.:...:.|.|||.::.|..|.|.|:..::........||||.||.|.|:
plant   354 DHEFQVGSYKIPAGWIFMGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVSRTYIPFGAGSRQCV 418

  Fly   466 GQKYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGIT------LRFKNKIKVKLVR 516
            |.::|    |..|.:.:.|..    .|..|:  ::|.|      |.|.|..:|:.::
plant   419 GAEFA----KLQMAIFIHHLS----RDRWSM--KIGTTILRNFVLMFPNGCEVQFLK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 96/513 (19%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 105/547 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.