DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP96A8

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:483 Identity:127/483 - (26%)
Similarity:210/483 - (43%) Gaps:75/483 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QLAKNSGDSYLQYSMGFSNFNVIDAHNAANI-----LNHPNLITKGVIYNFLHPFLRTGVLTATE 136
            ::.:||..::......|...:|:...:.|||     .|..|.| ||.|::.:......|::....
plant    66 EVLENSNMTFQFKGPWFVGMDVLATVDPANIHHIMSSNFSNYI-KGPIFHEIFEAFGDGIINTDA 129

  Fly   137 KKWHTRRSMLTRTFHLDILNQFQEIFIAESLK------FVSQFQ--GQNEVVVSLKDRISRF--- 190
            :.|...|:.....|:    :|..:.|.|.:.|      .|..|.  ...|:||.|:|...||   
plant   130 ELWRDWRNASQLIFN----HQRYQNFSASTTKTKVNDGLVPLFNHFANEEIVVDLEDVFQRFMYD 190

  Fly   191 -TLNSICET---AMGIKLDE------MAEKGDRYRANFHIIDEGLTRRIVNPLY-WDDCVYNMFT 244
             |...|..|   ::.|::.|      :.:.||.      |:...:|.|.|..|. |    ..:.|
plant   191 ITFIFITGTDPRSLSIEMPEVEFSKALDDVGDA------IVHRHITPRFVWKLQKW----IGIGT 245

  Fly   245 GHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTAD---DDICVIRKKRFAMLDT----LI 302
            ..|...|.........:|||.:|    |||.::..|..::   :|:..    .|..||.    ::
plant   246 EKKMLKAHATFDRVCEKIIAAKR----EELGSQGITYNSNGEREDLLT----SFIKLDATKYEVL 302

  Fly   303 CAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLN 367
            ....|..:.|..|.     .||.|.|:|:..|.:...|:|..........|||..::....|:.:
plant   303 KPSHDKFLRDFTIG-----FMAAGRDSTASTLTWFFWNLSKNPNVLTKILQEINTNLPRTGSDQD 362

  Fly   368 LSQ-LSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYW- 430
            :|. |:||.||...:.|:|||||.||...:..::|..|.:|..:.....|.|.::.:.|....| 
plant   363 MSSYLNKLVYLHGALSESMRLYPPIPFQRKSPIKEDVLPSGHKVKSNINIMIFIYAMGRMKTIWG 427

  Fly   431 ESPEEFRPERFLPQNCLKRH--PYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILPV--- 490
            |...||:|||::.:....||  .|.::.|:||.|.|:|:..||..|||::|.||::::|..|   
plant   428 EDAMEFKPERWISETGGVRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKIVSGQ 492

  Fly   491 -IDPKSIVFQVGITLRFKNKIKVKLVRR 517
             |:||.     |:.|..|:.:||.:.::
plant   493 KIEPKP-----GLILHMKHGLKVTMTKK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 127/478 (27%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 127/481 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.