DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:332 Identity:68/332 - (20%)
Similarity:112/332 - (33%) Gaps:108/332 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILVVIHWIYK-VN--------------------KDYNILAFFARRVQTKD------GKPLDS--- 46
            ::::::|::: ||                    ..|.||....|.....|      ..|||:   
plant    16 LILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFL 80

  Fly    47 --LVPMIKGRTVFAN---CFDLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAAN 106
              ::|.:. .||..:   ||...|.                          :.|..|:|......
plant    81 PRMMPFLH-HTVLKHGKKCFTWYGP--------------------------YPNVIVMDPETLRE 118

  Fly   107 ILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVS 171
            |::...|..|..|.:..|.|| :|:|.....||...||:|...|.:|.|......|.:...:.:.
plant   119 IMSKHELFPKPKIGSHNHVFL-SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLE 182

  Fly   172 QFQGQNEVVVSLKDRIS--------RFTLNSICETAMGIKLDEMAEKGDRYRANFHI-------I 221
            ::    |.:.|.|..:.        ..|.|.:..          |..||.|:....|       |
plant   183 EW----ERLASAKGTMELDSWTHCHDLTRNMLAR----------ASFGDSYKDGIKIFEIQQEQI 233

  Fly   222 DEGL--TRRIVNPLYWDDCVYNMFTGHKYNAALKVVHEFSREIIAKRRVLL---EEELENRRATQ 281
            |.||  .|.:..|       .:.|...|:|..|:   |..|::.|..:.::   |||::..|.|.
plant   234 DLGLLAIRAVYIP-------GSKFLPTKFNRRLR---ETERDMRAMFKAMIETKEEEIKRGRGTD 288

  Fly   282 TADDDIC 288
             .:.|.|
plant   289 -KNSDCC 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 52/246 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.