DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP87A2

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001184974.1 Gene:CYP87A2 / 837830 AraportID:AT1G12740 Length:478 Species:Arabidopsis thaliana


Alignment Length:579 Identity:124/579 - (21%)
Similarity:209/579 - (36%) Gaps:165/579 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMICLLWISVAILVVIHWIY----------------------------KVNKDYNILAFFARRVQ 37
            |...|:|:|:.::.:.||:|                            |.||..:|..|...|| 
plant     1 MWALLIWVSLLLISITHWVYSWRNPKCRGKLPPGSMGFPLLGESIQFFKPNKTSDIPPFIKERV- 64

  Fly    38 TKDGKPLDSLVPMIK----GRTVFAN---------------CFDLLGKDTDQVFTHLRQLAKNSG 83
             |:...:....|:.|    ||.|..:               ||.....||   |||:        
plant    65 -KNDVDMCRYGPIFKTNLVGRPVIVSTDADLSYFVFNQEGRCFQSWYPDT---FTHI-------- 117

  Fly    84 DSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTR 148
                     |...||                  |.::.|::.:|:..|||               
plant   118 ---------FGKKNV------------------GSLHGFMYKYLKNMVLT--------------- 140

  Fly   149 TFHLDILNQF---QEIFIAESLKFVSQFQGQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEK 210
            .|..|.|.:.   .|:...:.|:..|     |:..|.|||..:....:...:..:....|:.:| 
plant   141 LFGHDGLKKMLPQVEMTANKRLELWS-----NQDSVELKDATASMIFDLTAKKLISHDPDKSSE- 199

  Fly   211 GDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELE 275
              ..||||....:||   |..|  :|      ..|..|:..|:     .|   ||...:|...|:
plant   200 --NLRANFVAFIQGL---ISFP--FD------IPGTAYHKCLQ-----GR---AKAMKMLRNMLQ 243

  Fly   276 NRRATQTADDDICVIRKKRFAMLDTLI-CAEKDGLIDDIGISEEVD-----TLMAEGYDTTSIGL 334
            .||...         ||......|.:| ..:|:|.|    ::||:.     .|:...::|||:.|
plant   244 ERRENP---------RKNPSDFFDYVIEEIQKEGTI----LTEEIALDLMFVLLFASFETTSLAL 295

  Fly   335 VFGLMNMSLYAAEQELCYQEIQEH--IL----DDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPI 393
            ...:..:|   .:.|:..:..:||  ||    |..|.|...:...:.|...||.||.||...:|.
plant   296 TLAIKFLS---DDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFINETARLANIVPA 357

  Fly   394 MGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFS 458
            :.|:.|::.:.:: ..:|....:.:....:|.||:.::.|..|.|.|:..........: ::.|.
plant   358 IFRKALRDIKFKD-YTIPAGWAVMVCPPAVHLNPEMYKDPLVFNPSRWEGSKVTNASKH-FMAFG 420

  Fly   459 AGQRNCIGQKYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRR 517
            .|.|.|:|..:...:|...:..::..:: ...|...:|....|  |:|.|...|||.::
plant   421 GGMRFCVGTDFTKLQMAAFLHSLVTKYR-WEEIKGGNITRTPG--LQFPNGYHVKLHKK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 100/465 (22%)
CYP87A2NP_001184974.1 p450 4..475 CDD:299894 123/573 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.