DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP71A18

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:341 Identity:82/341 - (24%)
Similarity:136/341 - (39%) Gaps:73/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SQFQGQNEVVVSL-KDRISRFTLNSIC---ETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVN 231
            |..:..:|:.|:| .|..||.:|....   |||.|:|        .|.|....::.|......|.
plant   167 SSAENLSELFVTLTSDVTSRVSLGKKYWEDETAGGLK--------KRVRQIMELLREFPIGDYVP 223

  Fly   232 PLYWDDCVYNMFTGHKYNAALKVVHEFSREIIAK---------------RRVLLEEELENRRATQ 281
            .|.|.|.:      :.:|:.:..|.....:::.|               ..:||..|.|.....:
plant   224 ALAWIDRI------NGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSIEKEKNNGFK 282

  Fly   282 TADDDICVIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAA 346
            ...:||      :|.:||..|.          |||             ||..|:..:|...:...
plant   283 VQRNDI------KFMILDMFIG----------GIS-------------TSSTLLEWIMTELIRNP 318

  Fly   347 EQELCYQEIQEHILDDL----SNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENG 407
            |   |.:::|..|...:    |.:...::..:.||...|||..|::|.:|::..:.|.|.....|
plant   319 E---CMKKLQNEIRSTIRPHGSYIKEKEVENMRYLKAVIKEVFRVHPPLPLILPRLLTEDVKVKG 380

  Fly   408 LILPKRSQINIHVFDIHRNPKYW-ESPEEFRPERFLPQNCLKRH--PYAYIPFSAGQRNCIGQKY 469
            ..:...:::.|:.:.|||:|..| ...|||:|||.| .:.|..|  ...||||.:|:|.|.|...
plant   381 YDIAAGTEVLINAWSIHRDPAIWGPDAEEFKPERHL-DSTLDYHGQDLKYIPFGSGRRICPGINL 444

  Fly   470 AMQEMKTLMVVILKHF 485
            ||..::..:..::..|
plant   445 AMGLVEVTLANLVGRF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 82/341 (24%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 82/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.