DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p2 and CYP96A4

DIOPT Version :9

Sequence 1:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:441 Identity:104/441 - (23%)
Similarity:189/441 - (42%) Gaps:61/441 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AANILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTF-HLDILNQFQEIFIAESL 167
            ::|.:|:|    ||..:|.:..||..|:.......|...|:.....| |.|    ||...::.|:
plant    94 SSNFVNYP----KGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQD----FQSFSVSTSV 150

  Fly   168 KFVSQFQG---------QNEVVVSLKDRISRFTLNSICETAMGI---KLDEMAEKGDRYRANFHI 220
            ..:|  ||         :..::|.|:|...||..::......|.   .|.....|.:...|...:
plant   151 SKLS--QGLVPILDNAVEKHILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGV 213

  Fly   221 IDEGLTRRIVNPLYWDDCVYNMFTG----HKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQ 281
            .|....|.:.....|.   ...:.|    .|....|.|..:...:||:.:|    ||::|.....
plant   214 ADAMFYRHLKPAFLWS---IQSWIGVGIEKKMRRGLDVFDQMLGKIISAKR----EEIKNHGIHD 271

  Fly   282 TADDDICVIRKKRFAMLDTL----ICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLV--FGLMN 340
            :..:.:.|:  ..:..:||.    :....|..|.|..:.     |:....||||..|.  |.|::
plant   272 SKGEAMDVL--TYYMTIDTTKYKHLKPSNDKFIRDTILG-----LVIAARDTTSSALTWFFWLLS 329

  Fly   341 MSLYAAEQELCYQEIQEHILDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELE 405
            .:..|      ..:|::.|...:...:.:.|.||.||...:.||:|||||:|...:...:...|.
plant   330 KNPEA------MTKIRQEINKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDVLP 388

  Fly   406 NGLILPKRSQINIHVFDIHRNPKYW-ESPEEFRPERFLPQNCLKRH--PYAYIPFSAGQRNCIGQ 467
            :|..:.|..::.|.::.:.|....| :..|:|||||::..:.:.|.  .|.::.|:||.|.|:|:
plant   389 SGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGK 453

  Fly   468 KYAMQEMKTLMVVILKHF--KILPVIDPKSIVFQVGITLRFKNKIKVKLVR 516
            :....:|||:.|.|::::  |::....||.:   ..:.||.::.:||.:.:
plant   454 RLTFLQMKTVAVEIIRNYDIKVVEGHKPKPV---PSVLLRMQHGLKVSVTK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 104/437 (24%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 104/439 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.